PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G17920.1
Common NameF2H15.14, HDG12, HDGL2-12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 687aa    MW: 76527 Da    PI: 6.7015
Description homeodomain GLABROUS 12
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G17920.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.2e-192677556
                 SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                 +++t++q+++Le+ F+++++p++++r +L+++lgL  rq+k+WFqNrR+++k
  AT1G17920.1 26 HRHTPHQIQRLESTFNECQHPDEKQRNQLSRELGLAPRQIKFWFQNRRTQKK 77
                 689**********************************************988 PP

2START148.46.4e-472164372206
                  HHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS.....SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT-SEEEEEEEEC CS
        START   2 laeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv....dsgealrasgvvdmvlallveellddke...qWdetlakaetlevis 86 
                  +a +a++el+++ + +ep+W k          en++   ++ ++s++      +ea+r sgvv+ ++ +lv  l+++ +    +   +a+ +tl+vis
  AT1G17920.1 216 IAVTAMEELLRLLQTNEPLWIKTDgcrdvlNLENYENMFTRSSTSGGkknnLGMEASRSSGVVFTNAITLVDMLMNSVKlteLFPSIVASSKTLAVIS 313
                  7889*******************99997775555665555555555588999**************************88888888888********* PP

                  TT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX CS
        START  87 sg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlp 177
                  sg       al+lm  elq+lsplv  R+f ++Ry++q + g+w+iv vS + +q+ ++     R+ ++pSg+li+++sng+skvtwveh + +++ p
  AT1G17920.1 314 SGlrgnhgDALHLMIEELQVLSPLVTtREFCVLRYCQQIEHGTWAIVNVSYEFPQFISQ----SRSYRFPSGCLIQDMSNGYSKVTWVEHGEFEEQEP 407
                  ********************************************************994....56666****************************** PP

                  .HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 178 .hwllrslvksglaegaktwvatlqrqcek 206
                   h++++ +v++gla+ga +w atlqr ce+
  AT1G17920.1 408 iHEMFKDIVHKGLAFGAERWIATLQRMCER 437
                  ****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.1E-19879IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-20873IPR009057Homeodomain-like
PROSITE profilePS5007117.751979IPR001356Homeobox domain
SMARTSM003894.1E-182083IPR001356Homeobox domain
CDDcd000863.33E-182680No hitNo description
PfamPF000467.7E-172677IPR001356Homeobox domain
PROSITE patternPS0002705477IPR017970Homeobox, conserved site
PROSITE profilePS5084848.298206440IPR002913START domain
SuperFamilySSF559617.25E-33207438No hitNo description
CDDcd088752.90E-109210436No hitNo description
SMARTSM002349.3E-35215437IPR002913START domain
PfamPF018521.2E-38216437IPR002913START domain
Gene3DG3DSA:3.30.530.201.6E-8269436IPR023393START-like domain
SuperFamilySSF559613.48E-21458678No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010091Biological Processtrichome branching
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000017anatomyvascular leaf primordium
PO:0000027anatomylateral root tip
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000282anatomytrichome
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020003anatomyplant ovule
PO:0020020anatomynucellus
PO:0020041anatomystipule
PO:0020148anatomyshoot apical meristem
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007131developmental stageseedling development stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MEFLGDSQNH DSSETEKKNK KKKRFHRHTP HQIQRLESTF NECQHPDEKQ RNQLSRELGL  60
APRQIKFWFQ NRRTQKKAQH ERADNCALKE ENDKIRCENI AIREAIKHAI CPSCGDSPVN  120
EDSYFDEQKL RIENAQLRDE LERVSSIAAK FLGRPISHLP PLLNPMHVSP LELFHTGPSL  180
DFDLLPGSCS SMSVPSLPSQ PNLVLSEMDK SLMTNIAVTA MEELLRLLQT NEPLWIKTDG  240
CRDVLNLENY ENMFTRSSTS GGKKNNLGME ASRSSGVVFT NAITLVDMLM NSVKLTELFP  300
SIVASSKTLA VISSGLRGNH GDALHLMIEE LQVLSPLVTT REFCVLRYCQ QIEHGTWAIV  360
NVSYEFPQFI SQSRSYRFPS GCLIQDMSNG YSKVTWVEHG EFEEQEPIHE MFKDIVHKGL  420
AFGAERWIAT LQRMCERFTN LLEPATSSLD LGGVIPSPEG KRSIMRLAHR MVSNFCLSVG  480
TSNNTRSTVV SGLDEFGIRV TSHKSRHEPN GMVLCAATSF WLPISPQNVF NFLKDERTRP  540
QWDVLSNGNS VQEVAHITNG SNPGNCISVL RGFNASSSQN NMLILQESCI DSSSAALVIY  600
TPVDLPALNI AMSGQDTSYI PILPSGFAIS PDGSSKGGGS LITVGFQIMV SGLQPAKLNM  660
ESMETVNNLI NTTVHQIKTT LNCPSTA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.158270.0inflorescence| seed| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible255907_at0.0
Expression AtlasAT1G17920-
AtGenExpressAT1G17920-
ATTED-IIAT1G17920-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in apical meristems and young epidermal tissue including trichomes and stipules. Expressed in lateral root tips, the L1 layer of apical inflorescence meristems and early flower primordia, carpel and stamen filament epidermis, stigma papillae, ovule primordia, nucellus and embryo. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeobox-leucine zipper family protein belonging to the HD-ZIP IV family. Together with HDG11, it is involved in trichome branching.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G17920.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G17920
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934650.0AB493465.1 Arabidopsis thaliana At1g17920 mRNA for hypothetical protein, partial cds, clone: RAAt1g17920.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564041.20.0homeobox-leucine zipper protein HDG12
SwissprotQ9LMT80.0HDG12_ARATH; Homeobox-leucine zipper protein HDG12
TrEMBLC0SUW20.0C0SUW2_ARATH; Putative uncharacterized protein At1g17920 (Fragment)
STRINGAT1G17920.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30042665
Representative plantOGRP14515136
Publications ? help Back to Top
  1. Tavares R,Aubourg S,Lecharny A,Kreis M
    Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2.
    Plant Mol. Biol., 2000. 42(5): p. 703-17
    [PMID:10809443]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Schrick K,Nguyen D,Karlowski WM,Mayer KF
    START lipid/sterol-binding domains are amplified in plants and are predominantly associated with homeodomain transcription factors.
    Genome Biol., 2004. 5(6): p. R41
    [PMID:15186492]
  5. Nakamura M, et al.
    Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1363-75
    [PMID:16778018]
  6. Yu H, et al.
    Activated expression of an Arabidopsis HD-START protein confers drought tolerance with improved root system and reduced stomatal density.
    Plant Cell, 2008. 20(4): p. 1134-51
    [PMID:18451323]
  7. Marks MD,Wenger JP,Gilding E,Jilk R,Dixon RA
    Transcriptome analysis of Arabidopsis wild-type and gl3-sst sim trichomes identifies four additional genes required for trichome development.
    Mol Plant, 2009. 2(4): p. 803-22
    [PMID:19626137]
  8. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  9. Kamata N,Okada H,Komeda Y,Takahashi T
    Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.
    Plant J., 2013. 75(3): p. 430-40
    [PMID:23590515]